DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30184 and SH3PXD2A

DIOPT Version :9

Sequence 1:	NP_726341.1	Gene:	CG30184 / 246506	FlyBaseID:	FBgn0050184	Length:	223	Species:	Drosophila melanogaster
Sequence 2:	NP_001380944.1	Gene:	SH3PXD2A / 9644	HGNCID:	23664	Length:	1133	Species:	Homo sapiens

Alignment Length:	37	Identity:	13/37 - (35%)
Similarity:	18/37 - (48%)	Gaps:	2/37 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   188 QPSEHSGRKR-QVSSSESDSDAKEREEERIRNSEVFK 223
            :||..|..:| :....||..|. ..|||.|..:|.|:
Human   591 RPSPASSLQRARFKVGESSEDV-ALEEETIYENEGFR 626

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG30184	NP_726341.1	None
SH3PXD2A	NP_001380944.1	PX_FISH	6..124	CDD:132798
		SH3_Tks5_1	170..222	CDD:213007
		SH3_Tks5_2	269..322	CDD:213010
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	415..446
		SH3_Tks5_3	451..504	CDD:213012
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	505..840		13/37 (35%)
		SH3_Tks5_4	844..896	CDD:212952
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	899..924
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	941..964
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1029..1059
		SH3_Tks5_5	1076..1132	CDD:212953
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900