DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and TRA1

DIOPT Version :10

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_011967.1 Gene:TRA1 / 856499 SGDID:S000001141 Length:3744 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:27/107 - (25%)
Similarity:47/107 - (43%) Gaps:15/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VALYAGAIYLMHCTFALDLMFSHSRSRAN--------QKMHPQRSKRPLQLYFISRGAEAYLSRF 173
            :.:|.|  ||:..:.||.:....::...|        .|.:||.:.|..:|..|.  .::|::||
Yeast   415 IKIYTG--YLLDESLALTVQIMSAKLLLNLVERILKLGKENPQEAPRAKKLLMII--IDSYMNRF 475

  Fly   174 -WFFRRIAARMLTSAQPSEHSGRK-RQVSSSESDSDAKEREE 213
             ...|:....|....:...|...| .::.:|..|:| ||.||
Yeast   476 KTLNRQYDTIMKYYGRYETHKKEKAEKLKNSIQDND-KESEE 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
TRA1NP_011967.1 Tra1_central 290..935 CDD:466326 27/107 (25%)
Tra1_ring 947..2612 CDD:466357
FAT 2757..3106 CDD:396714
PIKK_TRRAP 3371..3676 CDD:270707
FATC 3713..3744 CDD:460514
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.