DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Pik3cb

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_445933.1 Gene:Pik3cb / 85243 RGDID:620917 Length:1070 Species:Rattus norvegicus


Alignment Length:122 Identity:23/122 - (18%)
Similarity:48/122 - (39%) Gaps:26/122 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MEEGVPHIFLLCGTYGGSVIICFISLIGAFYAERPTMKHEAL-----FGGILGG----------- 81
            ::..:....|.|..|   .:..::..||..:::...:|....     ||.|||.           
  Rat   894 LDRAIEEFTLSCAGY---CVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRER 955

  Fly    82 LHMVTVYANMYVATLEEFR---TERWPSFYACCRDNAIVALYAGAIYLMHCTFALDL 135
            :..:..|.  ::..:::.:   ||::..|..||.|..::....|.:::  ..|||.|
  Rat   956 VPFILTYD--FIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFI--TLFALML 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
Pik3cbNP_445933.1 PI3K_p85B 41..118 CDD:197539
PI3K_rbd 180..288 CDD:197540
C2_PI3K_class_I_beta_delta 324..501 CDD:176075
Nuclear localization signal (NLS). /evidence=ECO:0000250 410..418
PI3Ka_I 532..702 CDD:238444
PI3Kc_IA_beta 706..1067 CDD:270717 23/122 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.