DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and VPS34

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_013341.1 Gene:VPS34 / 850941 SGDID:S000004230 Length:875 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:23/99 - (23%)
Similarity:43/99 - (43%) Gaps:21/99 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ALDLMFS-----HSRSRANQKMHPQRSKRPLQLYF-----------ISRGAEAYLSRFWFFRRIA 180
            ||:|:.|     ..||.|..:: .:.|.:.|:||.           :|..::...|.|.....::
Yeast   374 ALELLGSTFKNLSVRSYAVNRL-KKASDKELELYLLQLVEAVCFENLSTFSDKSNSEFTIVDAVS 437

  Fly   181 ARMLTSAQ---PSEHSGRKRQVS-SSESDSDAKE 210
            ::.|:...   .:.|:.:|...| ||||::...|
Yeast   438 SQKLSGDSMLLSTSHANQKLLKSISSESETSGTE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
VPS34NP_013341.1 TEL1 <1..872 CDD:227365 23/99 (23%)
PI3Kc_III 528..871 CDD:270628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.