DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and TRRAP

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001362453.1 Gene:TRRAP / 8295 HGNCID:12347 Length:3873 Species:Homo sapiens


Alignment Length:108 Identity:30/108 - (27%)
Similarity:39/108 - (36%) Gaps:24/108 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LEEFRTERWPSFYA-CCRDNAIVALYAGAIYLMH--CTFALD----LMFSHSRSRANQKMHPQRS 153
            |....|..||...: .|.|.|  ..|:|.:.|.|  ..||:.    |...||..:|    |...:
Human  1865 LRRLMTFAWPCLLSKACVDPA--CKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKA----HAMEA 1923

  Fly   154 KRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRK 196
            :.      |.|.|.|.|:     ..:.|||....|...|..||
Human  1924 RA------IVRQAMAILT-----PAVPARMEDGHQMLTHWTRK 1955

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
TRRAPNP_001362453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..541
Interaction with TP53. /evidence=ECO:0000269|PubMed:12138177 2017..2395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2030..2051
Bipartite nuclear localization signal. /evidence=ECO:0000255 2054..2069
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2550..2585
TEL1 <2552..3873 CDD:227365
FAT 2868..3200 CDD:367004
PIKK_TRRAP 3510..3797 CDD:270707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.