DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and zgc:158659

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_005170630.1 Gene:zgc:158659 / 791141 ZFINID:ZDB-GENE-070112-492 Length:1070 Species:Danio rerio


Alignment Length:108 Identity:20/108 - (18%)
Similarity:34/108 - (31%) Gaps:41/108 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AERPTMKHEALFGGILGGLHMVTVYANMYVATLEEFRTERWPSFYA-CCRDNAIVALYAGAIYLM 127
            |.||:       .|.|.|||::.                  |.... ||..|.|:.         
Zfish     2 APRPS-------SGELWGLHLMP------------------PRILVDCCLPNGILV--------- 32

  Fly   128 HCTFALDLMFSHSRSRANQKMHPQRSKRPLQLYFISRGAEAYL 170
                :|:.:.....:...|::..:..|.|  ||.:.:....|:
Zfish    33 ----SLECLREAPLTSIKQQLFSEARKYP--LYHLLQEESCYI 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
zgc:158659XP_005170630.1 PI3K_p85B 32..107 CDD:280372 7/53 (13%)
PI3K_rbd 173..292 CDD:279173
C2_PI3K_class_I_alpha 327..486 CDD:176043
PI3Ka_I 528..697 CDD:238444
PKc_like 696..1065 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.