DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Atr

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_003750609.1 Gene:Atr / 685055 RGDID:1305796 Length:2636 Species:Rattus norvegicus


Alignment Length:277 Identity:56/277 - (20%)
Similarity:89/277 - (32%) Gaps:106/277 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FKMMELLL-SLGCCLVHWTCFMEEGVPHIFLLCGTYGGSVIICFISLIGAFY-----AERPTMKH 71
            |:..|||| .:||.|      :|.|.|.|..|.           |||:...:     ..:|....
  Rat   225 FRRQELLLWQIGCAL------LEHGSPKIRSLA-----------ISLLTELFELGGLPAQPASTF 272

  Fly    72 EALFGGILGGLHMVTVYAN---MY-------VATLEEFRTERWPSFYACCRDNAIVALYAGAIYL 126
            .:||..:|  .|::.:.|:   :|       |.||..|..|.:.:.              ..:||
  Rat   273 FSLFLELL--QHLIGMDADQLKLYEEPLSKLVKTLFPFEAEAYRNI--------------EPVYL 321

  Fly   127 MHCTFALDLMFSHSRSRANQKMHPQRSKRPL------QLYFISRGAEAYLSRFWFFRRI------ 179
            ......|.:||   ..|...::.....|..|      .|.|:..|.|:.|.    .|::      
  Rat   322 NVLLEKLRVMF---EDRVLMRLKSDLLKAALCHLLQYFLTFVPAGYESALQ----VRKVYVTDIC 379

  Fly   180 ---------------------AARMLTSAQPSEH-----------------SGRKRQVSSSESDS 206
                                 ||..:.|.:..|.                 |.::|::|||.|..
  Rat   380 RALVDVLGVQTHVGYLLGPFYAALKMESTEIIERIQCQAQQENLRGSNDGVSPKRRRLSSSLSSY 444

  Fly   207 DAKEREEERIRNSEVFK 223
            ....|:.|.|.:.::.|
  Rat   445 KRPSRQSEEINHVDMDK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
AtrXP_003750609.1 UME 1120..1226 CDD:214825
FAT 1766..2087 CDD:280429
TEL1 <2118..2636 CDD:227365
PIKKc_ATR 2285..2559 CDD:270625
FATC 2605..2636 CDD:280430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.