DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and CG34433

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001097984.1 Gene:CG34433 / 5740702 FlyBaseID:FBgn0085462 Length:233 Species:Drosophila melanogaster


Alignment Length:221 Identity:42/221 - (19%)
Similarity:76/221 - (34%) Gaps:69/221 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QVRSKKPVWFLFKMMELLLSLGCCLVHWTCFM---------EEGVPHIFLLCGTY---------- 47
            |..:.:||.|||..:|.:.::.|...|.:.|.         :....|.|.|...|          
  Fly    27 QPEALRPVLFLFYTLETIFNMFCMGYHISGFQAIELHVFEWDTVAIHYFYLMTFYFFMVVTLLQS 91

  Fly    48 -------------------GGSVIICFISLIGAFYAERPTMKHEALFGGILGGLHMVTVYANMYV 93
                               ..:::...|||...:.|||                   ..|...:.
  Fly    92 VNICTGNTPAVVTEIWKSSAAAIVFILISLSTMWDAER-------------------QFYVFFFA 137

  Fly    94 ATLEEFRTERW-------PSFYACCRDNAIVALYAGAIYLMHCTFALDLMFSHSRSRANQKMHPQ 151
            :.|.:..:..:       |.|: ..|..:|.:|..|.:||:|.|..:|:..::.|::...|    
  Fly   138 SELGDKNSHAFVEDRPIHPIFH-YLRGMSISSLTCGILYLLHATIMIDVKLTNDRNQGESK---- 197

  Fly   152 RSKRPLQLYFISRGAEAYLSRFWFFR 177
            .:..|:.|:.:.|.....||.:.:||
  Fly   198 GTYMPIPLFVLGRFIHRKLSAYDWFR 223



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR41152
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.