DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and CG34432

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001097983.1 Gene:CG34432 / 5740681 FlyBaseID:FBgn0085461 Length:213 Species:Drosophila melanogaster


Alignment Length:204 Identity:46/204 - (22%)
Similarity:82/204 - (40%) Gaps:43/204 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQVRSKKPVWFLFKMMELLLSLGCCLVHWTCFME-----EGVPHIFLLCGTYGGSVIICFISLIG 60
            :|..:.:|..|||..:|.:|::.|...|.|.|..     :.|.::.||  .:...:::.|...|.
  Fly    15 IQPGAVRPALFLFYTLETILNMICIGYHITGFQPLEWKGQEVHYLCLL--IFNVFMVMNFFQSIA 77

  Fly    61 AFYAERPTMKHE------ALFGGILGGLHMVTV------YANMYVATLEEFRTE--RWPSFYACC 111
            ......|.:..|      |.|..||  :..:|:      ::..:|.:.|:.|.|  ..|..:...
  Fly    78 ICTGRVPNVLMEIWKASVAAFAFIL--ISFLTMWDVEQQFSVFFVRSSEQVRGEHKELPPVHPII 140

  Fly   112 R---DNAIVALYAGAIYLMHCTFALDLMFSHSRSRANQKMHPQRSKR-PLQLYFISRGAEAYLSR 172
            |   ..:|.:|:.|.||::|.....|:       |...|:....|:. |:.|:.:.|.       
  Fly   141 RYKTGQSICSLFCGLIYMLHAVIMFDV-------RLTSKLIVSGSRHLPIPLFVLGRA------- 191

  Fly   173 FWFFRRIAA 181
              |.|:|.|
  Fly   192 --FHRKIYA 198



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR41152
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.