DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and pik3c2a

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_005159362.2 Gene:pik3c2a / 571356 ZFINID:ZDB-GENE-030328-39 Length:1691 Species:Danio rerio


Alignment Length:235 Identity:43/235 - (18%)
Similarity:79/235 - (33%) Gaps:77/235 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GCCLVHWTCFMEEGVPHIFLLCGTYGGSVIICFISLIGAFYAERPT--MKHEALFGGILGGLHMV 85
            |||:          ..:|..:|..:..::::            |.|  |.| ..||..||...|:
Zfish  1240 GCCV----------ATYILGICDRHNDNIML------------RSTGHMFH-IDFGKFLGHAQMI 1281

  Fly    86 TVYANMYVATLEEFRTERWPSFYACCRDNAIVALYAG-------AIYLMHCTFALDLMFSHSRSR 143
                       ..|:.:|.|  :....|.|.| :..|       .:::..|:.|.:|:..||...
Zfish  1282 -----------GSFKRDRAP--FVLTSDMAYV-INGGERPTSRFQLFVDLCSQAYNLIRKHSNLF 1332

  Fly   144 AN-----------------------QKMHPQRSKRPLQLYF---ISRGAEAYLSRFWFFRRIAAR 182
            .|                       ..:.||.:.....::|   |.....:..::|.||....|:
Zfish  1333 LNLLSLMTQSGLPELTGVQDLKYVYDALQPQTTDAEATIFFTRLIESSLGSVATKFNFFIHNLAQ 1397

  Fly   183 MLTSAQPSEHSGRKRQVSSSESDSDAKEREEERIRNSEVF 222
            :..|..||..     :...|.:......:::.:||::.||
Zfish  1398 LRFSGLPSND-----EPILSFAPRTYTMKQDGKIRDASVF 1432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
pik3c2aXP_005159362.2 Amelogenin <137..207 CDD:330537
PI3K_rbd 420..507 CDD:307097
C2A_PI3K_class_II 681..852 CDD:175979
PI3Ka 872..1038 CDD:320871
PKc_like 1045..1397 CDD:328722 34/193 (18%)
PX_PI3K_C2_alpha 1428..1536 CDD:132822 2/5 (40%)
C2B_PI3K_class_II 1565..1686 CDD:176027
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.