DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and si:rp71-17i16.5

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_021329311.1 Gene:si:rp71-17i16.5 / 564261 ZFINID:ZDB-GENE-090312-117 Length:1069 Species:Danio rerio


Alignment Length:33 Identity:8/33 - (24%)
Similarity:10/33 - (30%) Gaps:16/33 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKPVWFLFKMMELLLSLGCCLVHWTCFMEEGVP 38
            |||:|..|                :|...|..|
Zfish   782 KKPLWLEF----------------SCIQSEAPP 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
si:rp71-17i16.5XP_021329311.1 PI3K_rbd 189..292 CDD:321949
C2 332..506 CDD:326325
PI3Ka 557..702 CDD:320871
PI3Kc_IB_gamma 706..1069 CDD:270627 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.