DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and pik3ca

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_009304451.1 Gene:pik3ca / 561737 ZFINID:ZDB-GENE-130409-1 Length:1069 Species:Danio rerio


Alignment Length:262 Identity:49/262 - (18%)
Similarity:84/262 - (32%) Gaps:93/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKKPVW-----------FLFKMMEL-----------LLSLGCCLVHWTCFMEEGVPHIFLLCGTY 47
            :|:|:|           .||:..|:           :|:|....:....:..:|:....|   .|
Zfish   775 AKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRML---PY 836

  Fly    48 GGSVIICFISLIGAFYAERPTMKHEALFGGILGGL--HMVTVY--------ANMYVATLEEFRTE 102
            |...|...:.||....:....|:.:.. ||:.|.|  :..|::        ..||...::.|.. 
Zfish   837 GCLSIGDCVGLIEVVRSSHTIMQIQCK-GGLKGALQFNSTTLHQWLKDKNKGEMYDMAIDLFTR- 899

  Fly   103 RWPSFYACCRDNAIVALYAGAIYLM-----HCT----------FALDLMFSHSRSRANQKMHPQR 152
                  :|       |.|..|.:::     |.:          |.:|  |.|......:|...:|
Zfish   900 ------SC-------AGYCVATFILGIGDRHNSNIMVKDDGQLFHID--FGHFLDHKKKKFGYKR 949

  Fly   153 SKRPLQ-----LYFISRGA------------------EAYLS---RFWFFRRIAARMLTSAQPSE 191
            .:.|..     |..||:|.                  :|||:   ....|..:.:.||.|..|..
Zfish   950 ERVPFVLTQDFLIVISKGGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPEL 1014

  Fly   192 HS 193
            .|
Zfish  1015 QS 1016

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
pik3caXP_009304451.1 PI3K_p85B 31..108 CDD:197539
PI3K_rbd 173..292 CDD:307097
C2_PI3K_class_I_alpha 325..484 CDD:176043
PI3Ka_I 529..696 CDD:238444
PKc_like 695..1065 CDD:328722 49/262 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.