DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and pi4kaa

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_009303356.1 Gene:pi4kaa / 556956 ZFINID:ZDB-GENE-100204-2 Length:2128 Species:Danio rerio


Alignment Length:103 Identity:22/103 - (21%)
Similarity:41/103 - (39%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 HMVTVYANMYVATLEEFRTERWPSFYACCRDNAIVALYAGAIYLMHCTFAL-----DLMFSHSRS 142
            ::::||...|:..|....::|:...:....|.||....:|   :|.|..|:     |:.......
Zfish   872 YLLSVYRLEYMRVLRSQESDRFQVMFRYFEDRAIQKDKSG---MMQCVIAVGDKVFDVFLQMMAD 933

  Fly   143 RANQKMHPQRSKRPLQLYFIS---------RGAEAYLS 171
            :|..|.|.:..:...|...::         |.|:.|||
Zfish   934 KAKTKAHEEELESHAQFLLVNFNHIHKRIRRVADKYLS 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
pi4kaaXP_009303356.1 PI4Ka 1573..1748 CDD:238443
PI4Kc_III_alpha 1809..2127 CDD:270711
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.