powered by:
Protein Alignment CG30184 and pik3c3
DIOPT Version :9
Sequence 1: | NP_726341.1 |
Gene: | CG30184 / 246506 |
FlyBaseID: | FBgn0050184 |
Length: | 223 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021333200.1 |
Gene: | pik3c3 / 548346 |
ZFINID: | ZDB-GENE-050410-13 |
Length: | 887 |
Species: | Danio rerio |
Alignment Length: | 60 |
Identity: | 16/60 - (26%) |
Similarity: | 23/60 - (38%) |
Gaps: | 13/60 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 FGGILG------------GLHMVTVYANMYVATLEEFRTERWPSFYACCR-DNAIVALYA 121
||.||| ...||.....|.....:|||.:.:.:|....| .|.|:.|::
Zfish 762 FGYILGRDPKPLPPPMKLSKEMVEGMGGMQSEQYQEFRKQCYTAFLHLRRYSNLILNLFS 821
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.