DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and PI4KA

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_477352.3 Gene:PI4KA / 5297 HGNCID:8983 Length:2102 Species:Homo sapiens


Alignment Length:103 Identity:22/103 - (21%)
Similarity:41/103 - (39%) Gaps:17/103 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 HMVTVYANMYVATLEEFRTERWPSFYACCRDNAIVALYAGAIYLMHCTFAL-----DLMFSHSRS 142
            ::::||...|:..|.....:|:...:....|.||....:|   :|.|..|:     |...:....
Human   892 YLLSVYRLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSG---MMQCVIAVADKVFDAFLNMMAD 953

  Fly   143 RANQKMHPQRSKRPLQLYFIS---------RGAEAYLS 171
            :|..|.:.:..:|..|...::         |.|:.|||
Human   954 KAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLS 991

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
PI4KANP_477352.3 PI4Ka 1547..1722 CDD:238443
PI4Kc_III_alpha 1783..2101 CDD:270711
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.