DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and PIK3CG

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001269355.1 Gene:PIK3CG / 5294 HGNCID:8978 Length:1102 Species:Homo sapiens


Alignment Length:81 Identity:18/81 - (22%)
Similarity:28/81 - (34%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 SRSRANQKMHPQRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRKRQ-----V 199
            ||......|||..:.:||..|...:.|...:  |....|..........|.:..|...|     :
Human   190 SRDPKLYAMHPWVTSKPLPEYLWKKIANNCI--FIVIHRSTTSQTIKVSPDDTPGAILQSFFTKM 252

  Fly   200 SSSESDSDAKEREEER 215
            :..:|..|..|.:.|:
Human   253 AKKKSLMDIPESQSEQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
PIK3CGNP_001269355.1 PI3K_rbd 203..312 CDD:197540 13/68 (19%)
C2_PI3K_class_I_gamma 350..527 CDD:176044
PI3Ka_I 549..725 CDD:238444
PI3Kc_IB_gamma 729..1095 CDD:270627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.