DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and PIK3CA

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_006209.2 Gene:PIK3CA / 5290 HGNCID:8975 Length:1068 Species:Homo sapiens


Alignment Length:263 Identity:53/263 - (20%)
Similarity:83/263 - (31%) Gaps:96/263 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKKPVW-----------FLFKMMEL-----------LLSLGCCLVHWTCFMEEGVPHIFLLCGTY 47
            :|:|:|           .||:..|:           :|:|....:....:..:|:....|   .|
Human   775 AKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRML---PY 836

  Fly    48 GGSVIICFISLIGAFYAERPTMKHEALFGGILGGLHMVTVYANMYVATLEEFRTERWPSFYACCR 112
            |...|...:.||.........|:.:.. ||:.|.|..     |.:  ||.:     |      .:
Human   837 GCLSIGDCVGLIEVVRNSHTIMQIQCK-GGLKGALQF-----NSH--TLHQ-----W------LK 882

  Fly   113 DNAIVALYAGAIYLM------HC--TFAL--------DLM-----------FSHSRSRANQKMHP 150
            |.....:|..||.|.      :|  ||.|        ::|           |.|......:|...
Human   883 DKNKGEIYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGY 947

  Fly   151 QRSKRPLQ-----LYFISRGAE-----------------AYLS---RFWFFRRIAARMLTSAQPS 190
            :|.:.|..     |..||:||:                 |||:   ....|..:.:.||.|..|.
Human   948 KRERVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPE 1012

  Fly   191 EHS 193
            ..|
Human  1013 LQS 1015

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
PIK3CANP_006209.2 PI3K_p85B 32..107 CDD:396665
PI3K_rbd 173..292 CDD:197540
C2_PI3K_class_I_alpha 325..484 CDD:176043
PI3Ka_I 525..696 CDD:238444
PI3Kc_IA_alpha 695..1064 CDD:270719 53/263 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.