DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and PIK3C2B

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001364263.1 Gene:PIK3C2B / 5287 HGNCID:8972 Length:1634 Species:Homo sapiens


Alignment Length:213 Identity:40/213 - (18%)
Similarity:71/213 - (33%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GCCLVHWTCFMEEGVPHIFLLCGTYGGSVII-----CFISLIGAFYAERPTMKHEALFGGILGGL 82
            |||:          ..::..:|..:..::::     .|....|.|      :.|..:||.|....
Human  1183 GCCV----------ATYVLGICDRHNDNIMLKTTGHMFHIDFGRF------LGHAQMFGNIKRDR 1231

  Fly    83 HMVTVYANM-YVATLEEFRTERWPSFY-ACCRDNAIVA----LYAGAIYLMHCTFALDLMFSHSR 141
            ......::| ||....:..:.|:..|. .||:...::.    |:...:.||......:|......
Human  1232 APFVFTSDMAYVINGGDKPSSRFHDFVDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDL 1296

  Fly   142 SRANQKMHPQRSKRPLQLYFI-----SRGAEAYLSRFWFFRRIAARMLTSAQPS---EHSGRKRQ 198
            ......:.||.::.....||.     |.|:.|....| |...:|....|.:...   ..:.|...
Human  1297 KYVYDALRPQDTEANATTYFTRLIESSLGSVATKLNF-FIHNLAQMKFTGSDDRLTLSFASRTHT 1360

  Fly   199 VSSSESDSDAKEREEERI 216
            :.||...||......|:|
Human  1361 LKSSGRISDVFLCRHEKI 1378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
PIK3C2BNP_001364263.1 Interaction with GRB2. /evidence=ECO:0000269|PubMed:11533253 2..298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..188
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..315
PI3K_rbd 364..466 CDD:395642
C2A_PI3K_class_II 622..794 CDD:175979
PI3Ka_II 813..981 CDD:238441
PI3Kc_C2_beta 987..1340 CDD:119421 31/173 (18%)
PX_PI3K_C2_beta 1369..1477 CDD:132823 3/10 (30%)
C2B_PI3K_class_II 1505..1627 CDD:176027
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.