DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and PIK3C2A

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001308307.1 Gene:PIK3C2A / 5286 HGNCID:8971 Length:1686 Species:Homo sapiens


Alignment Length:220 Identity:43/220 - (19%)
Similarity:77/220 - (35%) Gaps:47/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GCCLVHWTCFMEEGVPHIFLLCGTYGGSVII-----CFISLIGAFYAERPTMKHEALFGGILGGL 82
            |||:          ..::..:|..:..::::     .|....|.|      :.|..:||......
Human  1238 GCCV----------ATYVLGICDRHNDNIMLRSTGHMFHIDFGKF------LGHAQMFGSFKRDR 1286

  Fly    83 HMVTVYANM-YVATLEEFRTERWPSFY-ACCRDNAIVA----LYAGAIYLM------HCTFALDL 135
            ....:.::| ||....|..|.|:..|. .||:...::.    |:...:.||      ..|...||
Human  1287 APFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLFLNLLSLMIPSGLPELTSIQDL 1351

  Fly   136 MFSHSRSRANQKMHPQRSKRPLQLYF---ISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRKR 197
            .:      ....:.||.:.....::|   |.....:..::|.||....|::..|..||..     
Human  1352 KY------VRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSGLPSND----- 1405

  Fly   198 QVSSSESDSDAKEREEERIRNSEVF 222
            :...|.|......|::.||:...||
Human  1406 EPILSFSPKTYSFRQDGRIKEVSVF 1430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
PIK3C2ANP_001308307.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
Interaction with clathrin, sufficient to induce clathrin assembly. /evidence=ECO:0000269|PubMed:16215232 2..142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..367
PI3K_rbd 409..512 CDD:279173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..639
C2A_PI3K_class_II 677..849 CDD:175979
PI3Ka_II 870..1038 CDD:238441
PI3Kc_C2_alpha 1043..1395 CDD:270720 32/178 (18%)
PX_PI3K_C2_alpha 1426..1534 CDD:132822 2/5 (40%)
Interaction with PtdIns(4,5)P2-containing membranes. /evidence=ECO:0000250|UniProtKB:Q61194 1488..1493
C2B_PI3K_class_II 1560..1681 CDD:176027
Nuclear localization signal. /evidence=ECO:0000269|PubMed:11606566 1608..1619
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.