DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and fwd

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001356971.1 Gene:fwd / 45374 FlyBaseID:FBgn0004373 Length:1682 Species:Drosophila melanogaster


Alignment Length:160 Identity:33/160 - (20%)
Similarity:55/160 - (34%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGL-------------HMVTVYANMYVATLEEFRTERWPSFYAC-CRDNA-IVALYAGAIYLMH 128
            ||||             .:...|.||  ..:.|..|....|..:| .||.. .|....|.:.|.|
  Fly  1303 LGGLQFQEDDVWSQEEDEITAQYLNM--RKVSERDTISQISLDSCDSRDQGPPVVFNIGDVRLRH 1365

  Fly   129 CTFALDLMFSHSRSRANQKMHPQRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHS 193
            |:   :|...:::|.:|....|               :.|.|...|..:.   :::..:.|..|.
  Fly  1366 CS---NLSCENTKSFSNDPEDP---------------SAAALKEPWHEKE---KLIRESSPYGHL 1409

  Fly   194 GRKRQVSSSESDSDAKEREEERIRNSEVFK 223
            ...|.:|:.....|...:|....:..::||
  Fly  1410 SNWRLLSAIVKCGDDLRQELMATQLLQMFK 1439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
fwdNP_001356971.1 PI4Kc_III_beta 1385..1674 CDD:270712 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.