DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and pik3cd

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_957493.1 Gene:pik3cd / 394174 ZFINID:ZDB-GENE-040426-1128 Length:1039 Species:Danio rerio


Alignment Length:120 Identity:23/120 - (19%)
Similarity:47/120 - (39%) Gaps:26/120 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MEEGVPHIFLLCGTYGGSVIICFISLIGAFYAERPTMKHEAL-----FGGILG------GLH--- 83
            :::.:....|.|..|   .:..::..||..:::...::....     ||..||      |::   
Zfish   864 LDQAIEEFTLSCAGY---CVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKSKFGINRER 925

  Fly    84 --MVTVYANMYVATLEEFRT---ERWPSFYACCRDNAIVALYAGAIYLMHCTFAL 133
              .:..|.  :|..::|.||   |::..|..||.....:....|.:::.  .|||
Zfish   926 VPFILTYD--FVHVIQEGRTNNSEKFERFRVCCEQAYKILCRNGTLFVN--LFAL 976

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
pik3cdNP_957493.1 PI3K_p85B 32..107 CDD:280372
PI3K_rbd 188..280 CDD:295323
C2_PI3K_class_I_beta_delta 315..481 CDD:176075
PI3Ka_I 505..676 CDD:238444
PI3Kc_IA_delta 676..1038 CDD:270718 23/120 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.