DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Pi3K59F

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_477133.1 Gene:Pi3K59F / 37733 FlyBaseID:FBgn0015277 Length:949 Species:Drosophila melanogaster


Alignment Length:108 Identity:29/108 - (26%)
Similarity:39/108 - (36%) Gaps:36/108 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LHMVTV-YANMYVATLEE------FR------TERWPSFYAC----CRDNAIVALYAGAIYL-MH 128
            ||.:.. |...||.:.||      ||      .:....|..|    ..|....||:..|.:. |.
  Fly   297 LHTIVYRYPPTYVLSSEEQDLVWKFRFYLSSHKKALTKFLKCINWKLEDEVTQALWMLANWAPMD 361

  Fly   129 CTFALDLM---FSHSRSRANQKMHPQRSKRPLQLYFISRGAEA 168
            ...||:|:   |:          |||..|     |.:||.|:|
  Fly   362 VEDALELLSPTFT----------HPQVRK-----YAVSRLAQA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
Pi3K59FNP_477133.1 C2_PI3K_class_III 27..186 CDD:176042
PI3Ka_III 284..561 CDD:238442 29/108 (27%)
PI3Kc_III 601..945 CDD:270628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.