DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Atr

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_063917.1 Gene:Atr / 245000 MGIID:108028 Length:2641 Species:Mus musculus


Alignment Length:273 Identity:57/273 - (20%)
Similarity:91/273 - (33%) Gaps:98/273 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FKMMELLL-SLGCCLVHWTCFMEEGVPHIFLLCGTYGGSVIICFISLIGAFY-----AERPTMKH 71
            |:..|||| .:||.|      :|.|.|.|..|.           |||:...:     ..:|....
Mouse   225 FRRQELLLWQIGCAL------LEHGSPKIRSLA-----------ISLLTELFELGGLPAQPASTF 272

  Fly    72 EALFGGILGGLHMVTVYAN---MY-------VATLEEFRTERWPSFYACCRDNAIVALYAGAIYL 126
            .:||..:|  .|:|.:.|:   :|       :.||..|..|.:.:.              ..:||
Mouse   273 FSLFLELL--QHLVGMDADQLKLYEEPLSKLLKTLFPFEAEAYRNI--------------EPVYL 321

  Fly   127 MHCTFALDLMFSHSRSRANQKMHPQRSKRPL------QLYFISRGAEA-------YLSRFW---- 174
            ......|.:||   ..|...::.....|..|      .|.|:..|.|:       |::...    
Mouse   322 NVLLEKLSVMF---EDRVLMRLKSDLLKAALCHLLQYFLTFVPAGYESALQVRKVYVTNICRALV 383

  Fly   175 ---------------FF-------RRIAARMLTSAQPSEHSG-------RKRQVSSSESDSDAKE 210
                           |:       :.|..|:...||....||       ::|::|||.|......
Mouse   384 DALGVQKHVGYLLGPFYAALKMESKEIIERIQCQAQQENLSGNNDEVSPKRRKLSSSLSSYKKPS 448

  Fly   211 REEERIRNSEVFK 223
            |:.|.|.:.::.|
Mouse   449 RQPEEIIHVDMDK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
AtrNP_063917.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..447 7/23 (30%)
HEAT repeat 690..720 CDD:293787
HEAT repeat 729..788 CDD:293787
HEAT 1 799..835
HEAT repeat 802..837 CDD:293787
UME 1119..1225 CDD:214825
HEAT 2 1329..1365
NR_LBD 1529..>1607 CDD:299703
FAT 1771..2092 CDD:280429
TEL1 <2123..2641 CDD:227365
PIKKc_ATR 2290..2564 CDD:270625
FATC 2610..2641 CDD:280430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.