DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Pik3c2b

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001092746.2 Gene:Pik3c2b / 240752 MGIID:2685045 Length:1632 Species:Mus musculus


Alignment Length:205 Identity:42/205 - (20%)
Similarity:69/205 - (33%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GCCLVHWTCFMEEGVPHIFLLCGTYGGSVII-----CFISLIGAFYAERPTMKHEALFGGILGGL 82
            |||:          ..:|..:|..:..::::     .|....|.|      :.|..:||.|....
Mouse  1182 GCCV----------ATYILGICDRHNDNIMLKTTGHMFHIDFGRF------LGHAQMFGNIKRDR 1230

  Fly    83 HMVTVYANM-YVATLEEFRTERWPSFY-ACCRDNAIVA----LYAGAIYLMHCTFALDLMFSHSR 141
            ......::| ||....:..:.|:..|. .||:...::.    |:...:.||......:|......
Mouse  1231 APFVFTSDMAYVINGGDKPSSRFHDFVDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDL 1295

  Fly   142 SRANQKMHPQRSKRPLQLYFI-----SRGAEAYLSRFWFFRRIAA--------RMLTSAQPSEH- 192
            ......:.||.::.....||.     |.|:.|....| |...:|.        |:..|..|..| 
Mouse  1296 KYVYDALRPQDTEANATTYFTRLIESSLGSVATKLNF-FIHNLAQMKFTGSDDRLTLSFAPRTHT 1359

  Fly   193 ---SGRKRQV 199
               |||.|.|
Mouse  1360 LKSSGRIRDV 1369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
Pik3c2bNP_001092746.2 PI3K_rbd 363..465 CDD:366310
C2A_PI3K_class_II 621..793 CDD:175979
PI3Ka_II 812..980 CDD:238441
PI3Kc_C2_beta 986..1339 CDD:119421 32/173 (18%)
PX_PI3K_C2_beta 1368..1476 CDD:132823 1/2 (50%)
C2B_PI3K_class_II 1504..1626 CDD:176027
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.