DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30184 and Smg1

DIOPT Version :9

Sequence 1:	NP_726341.1	Gene:	CG30184 / 246506	FlyBaseID:	FBgn0050184	Length:	223	Species:	Drosophila melanogaster
Sequence 2:	NP_001026984.1	Gene:	Smg1 / 233789	MGIID:	1919742	Length:	3658	Species:	Mus musculus

Alignment Length:	80	Identity:	20/80 - (25%)
Similarity:	31/80 - (38%)	Gaps:	15/80 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 TCFMEE-GVPHIFLLCGTYGGSVIICFISLIGAFYAERPTMKHEALFGGILGGLHMVTVYANMY- 92
            |.|::. |..|:...|....|.|        ||...:|     .::..|.|..||.....|..|
Mouse  2599 TAFLQNAGQAHLISQCEQLEGEV--------GALLQQR-----RSVLRGCLEQLHHYATVALQYP 2650

  Fly    93 VATLEEFRTERWPSF 107
            .|..::.|.|:|.::
Mouse  2651 KAIFQKHRIEQWKAW 2665

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
CG30184	NP_726341.1	None
Smg1	NP_001026984.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..99
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	116..142
		SMG1	629..1240	CDD:292413
		HEAT	1815..1850
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1896..1917
		PIKKc_SMG1	2119..2424	CDD:270714
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	3565..3588
		FATC	3628..3657	CDD:280430
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900