DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and SMG1

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_005255239.1 Gene:SMG1 / 23049 HGNCID:30045 Length:3689 Species:Homo sapiens


Alignment Length:80 Identity:20/80 - (25%)
Similarity:31/80 - (38%) Gaps:15/80 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TCFMEE-GVPHIFLLCGTYGGSVIICFISLIGAFYAERPTMKHEALFGGILGGLHMVTVYANMY- 92
            |.|::. |..|:...|....|.|        ||...:|     .::..|.|..||.....|..| 
Human  2629 TAFLQNAGQAHLISQCEQLEGEV--------GALLQQR-----RSVLRGCLEQLHHYATVALQYP 2680

  Fly    93 VATLEEFRTERWPSF 107
            .|..::.|.|:|.::
Human  2681 KAIFQKHRIEQWKTW 2695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
SMG1XP_005255239.1 SMG1 631..1242 CDD:292413
PIKKc_SMG1 2121..2454 CDD:270714
FATC 3659..3688 CDD:280430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.