DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Pik3c3

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_852079.2 Gene:Pik3c3 / 225326 MGIID:2445019 Length:887 Species:Mus musculus


Alignment Length:192 Identity:39/192 - (20%)
Similarity:67/192 - (34%) Gaps:45/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GGSVIICFISLIGAFYAERPTMKHEALFGGILGGLHMVTVYANMYV-------------ATLEEF 99
            ||:.    :||.|.             :|....|:|.:.|:.|:..             :||.|.
Mouse   123 GGTT----VSLFGK-------------YGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSED 170

  Fly   100 RTERWPSFYACCRDNAIVALYAGAIYLMHCTFALDLMFSHSRSRANQKMHPQRSKRPLQ------ 158
            :..|........|...:|.:    .:|...||....|.:.|..|::..|:.....|.::      
Mouse   171 QMSRLAKLTKAHRQGHMVKV----DWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEY 231

  Fly   159 --LYFISRGAEA--YLSRFWFFRRIAARM-LTSAQPSEHSGRKRQVSSSESDSDAKEREEER 215
              :|:...|.|:  .|:.|...:....:| :.:...|:|....|.:.|..||.|.|.....|
Mouse   232 GIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
Pik3c3NP_852079.2 C2_PI3K_class_III 26..186 CDD:176042 15/79 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..170 2/20 (10%)
PI3Ka_III 283..503 CDD:238442 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..466
PI3Kc_III 539..883 CDD:270628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.