DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Prkdc

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_035289.2 Gene:Prkdc / 19090 MGIID:104779 Length:4128 Species:Mus musculus


Alignment Length:210 Identity:50/210 - (23%)
Similarity:72/210 - (34%) Gaps:68/210 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSKKPVWFLFKMMELLLSLGCCLVH-----------WTCFMEE---------GVPHIFLLCGTYG 48
            :||.|...|.|:.|||..||  .||           :..|:.|         ..|...:|.|...
Mouse   163 KSKLPDTVLEKVYELLGVLG--EVHPSEMINHSENLFRAFLGELKTQMTSTVREPKFPVLAGCLK 225

  Fly    49 G-SVIICFIS------------LIG-AFYAERP--TMKHEALFGGILGGLHMVTVYANMYVATLE 97
            | |.::|..:            :.| .|.|.||  .||..|:   .|.||.::|::|:       
Mouse   226 GLSSLLCNFTKSMEEDPQTSKEIFGFTFKAIRPQIEMKRYAV---PLAGLRLLTLHAS------- 280

  Fly    98 EFRTERWPSFYACCRDNAIVALYAGAIYLMHCTFALDLMFSHSRSRANQKMHPQRSKRPLQLYF- 161
                    .|.||..||.|....           .|....||:.....:..|........|:.| 
Mouse   281 --------QFTACLLDNYITLFE-----------VLSKWCSHTNVELKKAAHSALESFLRQISFT 326

  Fly   162 ISRGAEAYLSRFWFF 176
            ::..||.:.||..:|
Mouse   327 VAEDAELHKSRLKYF 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
PrkdcNP_035289.2 HEAT 1 288..323 7/45 (16%)
HEAT 2 1001..1037
HEAT 3 1050..1086
Interaction with C1D. /evidence=ECO:0000250 1501..1536
Leucine-zipper 1501..1536
TPR 1 1720..1753
ArAE_1_C <1766..1822 CDD:288564
NUC194 1812..2198 CDD:285387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2049..2071
KIP-binding. /evidence=ECO:0000250 2432..3213
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2614..2635
FAT 3024..3470 CDD:280429
PIKKc_DNA-PK 3719..4014 CDD:270716
FATC 4097..4128 CDD:280430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.