DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Pik3cd

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_006538704.1 Gene:Pik3cd / 18707 MGIID:1098211 Length:1074 Species:Mus musculus


Alignment Length:50 Identity:12/50 - (24%)
Similarity:22/50 - (44%) Gaps:14/50 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YAERPTMKHEALFGG------------ILGGL--HMVTVYANMYVATLEE 98
            ||.:...:||.|:|.            :..||  |:..|:::..:|..:|
Mouse   239 YALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
Pik3cdXP_006538704.1 PI3K_p85B 32..107 CDD:396665
PI3K_rbd 182..281 CDD:395642 10/41 (24%)
C2_PI3K_class_I_beta_delta 314..481 CDD:176075
PI3Ka 504..713 CDD:214537
PI3Kc_IA_delta 705..1072 CDD:270718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.