DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Y75B8A.24

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_499596.2 Gene:Y75B8A.24 / 176653 WormBaseID:WBGene00013557 Length:2106 Species:Caenorhabditis elegans


Alignment Length:89 Identity:22/89 - (24%)
Similarity:35/89 - (39%) Gaps:25/89 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LDLMFSHSRSRANQKMHPQRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRKR 197
            |||.:|              |..|:|    |.....:|:|| ..:|...|.|      ||.|.:.
 Worm  1783 LDLDYS--------------SGTPMQ----SAAKAPFLARF-RVKRCGVREL------EHIGLQA 1822

  Fly   198 QVSSSESDSDAKEREEERIRNSEV 221
            |.......::|...|.:::::|.|
 Worm  1823 QSEHGGKTTEADLEELKKVQDSRV 1846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
Y75B8A.24NP_499596.2 PI4Ka 1544..1720 CDD:238443
PI4Kc_III_alpha 1781..2105 CDD:270711 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.