DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30184 and Pi4kb

DIOPT Version :9

Sequence 1:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001280644.1 Gene:Pi4kb / 107650 MGIID:1334433 Length:816 Species:Mus musculus


Alignment Length:155 Identity:32/155 - (20%)
Similarity:49/155 - (31%) Gaps:52/155 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NMYVATLEEFRTERWPSFYACCRDNAIVALYAGAIYLMHCTFALDLMFS---HSRSRANQK---- 147
            |||:...|:......|.....||.:...:|...   |:...::.|:..|   |||....:|    
Mouse   181 NMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCA---LLLGAYSSDMHISTQRHSRGTKLRKLILS 242

  Fly   148 --MHPQRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHSGRKRQVSSSESDSDAK- 209
              :.|...||.|.                        .|:.|..:..|..||....|:||:.|. 
Mouse   243 DELKPAHRKRELP------------------------TLSPAPDTGLSPSKRTHQRSKSDATASI 283

  Fly   210 ---------------EREEERIRNS 219
                           |.|:|.:.:|
Mouse   284 SLSSNLKRTASNPKVENEDEELSSS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30184NP_726341.1 None
Pi4kbNP_001280644.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Interaction with ACBD3. /evidence=ECO:0000250|UniProtKB:Q9UBF8 2..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..318 16/83 (19%)
PI4Kc_III_beta 529..816 CDD:270712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.