DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and asic1a

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_021333995.1 Gene:asic1a / 791696 ZFINID:ZDB-GENE-040513-2 Length:614 Species:Danio rerio


Alignment Length:530 Identity:112/530 - (21%)
Similarity:178/530 - (33%) Gaps:136/530 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SIHLLERLF-----------WLAVVVSSVIAALVLSRLQLERYFSSPTVISVDRDYRGWNGSLPA 115
            ::|.:..:|           |:...:||:...:.:...:::.|...|.|..:| :........||
Zfish   144 TLHGISHIFSYEKITAKCCLWVVFFLSSLTFLMYVCIDRIQFYLEYPHVTKLD-EITTPVMVFPA 207

  Fly   116 VTLCYYDHI--------DSFKANEYI------QEMWNVSIIDEDYFYFMDFLYAVVNATAGNYAE 166
            ||:|..:.|        |.:.|.|.:      .|:....:::|                  :..|
Zfish   208 VTICNLNSIRFSRITRNDLYHAGELLALLNSRHEVREAHLVEE------------------SVME 254

  Fly   167 LAKFAEDERF---DQIDLYEMIQRVDRPFEQVISSFD--------AGFQVHVQRVMTERGACYAI 220
            :.|...|.|.   ...:::|...|.....:.::.|..        ..|.|    |.|..|.||..
Zfish   255 VLKSKTDFRSFKPRHFNMWEFYNRTGHDIKDMLLSCQFRGSPCRPEDFSV----VFTRYGKCYTF 315

  Fly   221 NS-----PMSTVLSGQPVAYELMPQPLSCQYGKQQCYIRMDLYESTGVLDVHSPFEVSATEANI- 279
            ||     |..:|..|.....|:|..            |:.|.|     |.|....:.|:.||.| 
Zfish   316 NSGETGPPRVSVKGGMGNGLEIMLD------------IQQDEY-----LPVWGESDESSFEAGIK 363

  Fly   280 VALHKSDE----------ITASFKVLETVASKNLRQLSVAQRKCVFNNEETSNLKIYSKSLCLAR 334
            |.:|..||          :...|:...:...:.|..|......|......:...:.||.|.|...
Zfish   364 VQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKSTPPSSDYFRAYSISACRTD 428

  Fly   335 CRAVMALEMCNCVPFFYPYVDGPSCNPAGF-EC---LLDFKWPIWALHICKCPSTCTEIEYTMQ- 394
            |.....:|.|||.....| .|.|.|.|..: ||   .|||.....: ..|.|.:.|....|:.: 
Zfish   429 CETRYLVENCNCRMVHMP-GDAPYCTPVLYKECAHPALDFLVETDS-DYCSCETPCNITRYSKEL 491

  Fly   395 -------------TVKKSSWGVKNNEEVASSETATSSFRWDLIPPKVRMRRDVVYSFEDLVVSFG 446
                         ..||.|   |:.:.:..:......|...|....:..|:  .|....|:...|
Zfish   492 SFVKIPSKASVKYLAKKYS---KSEKYITENVMVLDVFFEALNYETIEQRK--AYEVAGLLGDIG 551

  Fly   447 GVLALFVGVSVMGLVEMVHVLVNNLLLDVFTLLRLMLGRLRRCWRRDDHMREANHHHHA------ 505
            |.:.||:|.|::.::|         |.|.  |..:|..||.||..:..|....|..|:|      
Zfish   552 GQMGLFIGASILTILE---------LFDY--LYEVMKYRLCRCSNKKHHNNNNNTDHNAVFSLDD 605

  Fly   506 -NAHAHARLH 514
             |.|. ::.|
Zfish   606 VNCHV-SKFH 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 97/471 (21%)
asic1aXP_021333995.1 ASC 136..582 CDD:322155 103/495 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.