DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and ppk30

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster


Alignment Length:474 Identity:98/474 - (20%)
Similarity:172/474 - (36%) Gaps:129/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VSSVIAALVLSRLQLERYFSSPTVISVDR-DYRGWNGSLPAVTLCYYDHIDSFKANEYIQEMWNV 139
            :.:.:|.:.:|.|..||||......|::| |........||||:... ::...|| |.:.:.:|:
  Fly    47 IMAALATVYVSILSSERYFYYWVQTSIERTDMHVSEIDFPAVTIIPI-NLSILKA-EKLSKAYNL 109

  Fly   140 SIIDEDYFYFMDFLYAVV-------NATAGNYAELAKFAEDERFD--QIDLYEMIQRVDRPF--- 192
                         :.:||       ..|..|:.|   |:|.|.::  ...:|:.:|...:.|   
  Fly   110 -------------VQSVVWQTPMSARLTDENFTE---FSELENWNAQSWGIYQALQMNCQHFFTE 158

  Fly   193 ----EQVISSFDAGFQVHVQRVMTERGACYAINSPMSTVLSGQPVAYELMPQPL-SC-QYGKQQC 251
                .:.::..|.     .:...|..|..:..||.:|   ||:.   |..|..: || .|.....
  Fly   159 CQWRRKAMNCCDL-----FRPTKTFNGFAFEFNSLVS---SGRD---ETWPWSVASCGSYSGLNV 212

  Fly   252 YIR--MDLY--ESTGVLDVHSPFEVSATEANIVALHKSDEITASFKVLETVASKNLRQLSVAQRK 312
            .|:  ..||  .:.||: ||.|.::....   :.....|.|....:.|...|..::|...|..|:
  Fly   213 KIKRQQGLYTLNTMGVI-VHEPTQLLGMS---IDYSSEDRIVVPVEPLHFTAELDVRARPVQMRR 273

  Fly   313 CVFNNEETSNLKIYSKSLCLARCRAVMALEMCNCVPFFYPYVDGP-------------------- 357
            |.|.||..:.   .|:|.|:.:|.....:..|||      .::.|                    
  Fly   274 CYFENEIPTG---KSRSECIYKCHVNYIISKCNC------SLELPVKATQDEDNIAAAKESNGRR 329

  Fly   358 SCNPAGFECLLDFKWPIWALH--------------ICKCPSTCTEIEYTMQTVKKSSWGVKNNEE 408
            .|......|....:..::::.              .|.|...|...:|...|.         .|:
  Fly   330 ICGVKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDCGCFPQCGHTQYHTSTY---------TEK 385

  Fly   409 VASSETATSSFRWDLIPPKVRMRRDVVYSFE--------DLVVSFGGVLALFVGVSVMGLVEMVH 465
            :::.....::...|     |..:.:.::|:.        ||:||:||:..|.:|:||:|.:    
  Fly   386 MSAHTNLAAAIEID-----VYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCI---- 441

  Fly   466 VLVNNLLLDVFTLLRLMLG 484
                |.|||.|...|:..|
  Fly   442 ----NELLDRFACCRIPHG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 91/452 (20%)
ppk30NP_001263076.1 ASC 47..446 CDD:279230 93/462 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.