DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and asic2

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_005164179.1 Gene:asic2 / 407669 ZFINID:ZDB-GENE-040513-4 Length:564 Species:Danio rerio


Alignment Length:559 Identity:120/559 - (21%)
Similarity:193/559 - (34%) Gaps:142/559 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WIRGAAARILRGLLALLWLILAGCGRLF-------------------GRLRDVVAQAG----AET 50
            |:...|.|  ...||.||.::|..||..                   |..||.:::..    :.|
Zfish     9 WLGDEAVR--PAALAALWALMALEGRCLRPASPTPGQRRARRRHTRPGTPRDDLSRLTVALLSRT 71

  Fly    51 GLLALSLCVNRSIHLLERLFWLAVVVSSVIAALVLSRLQLERYFSSPTVISVDRDYRGWNGSL-- 113
            .|..|....:.|..|..|.||:....:.:...|..|..:|..:.:.||...|..:   |...|  
Zfish    72 RLHGLRHICSPSNSLSRRAFWMIAFCTCLGLLLSWSSNRLLHWLAFPTHTRVHTE---WAKELAF 133

  Fly   114 PAVTLCYYDHIDSF---KANEYIQEMWNVSIIDEDYFYFMDFLYAVVNATA-------------G 162
            |.||:|..:.:..:   |::.|....|            :..|.|  |.||             |
Zfish   134 PTVTICNNNPVRLYHLTKSDLYFAGHW------------LGLLLA--NRTARPLVLDLLQDDRRG 184

  Fly   163 NYAELAK---FAEDERFDQIDLYEMIQRVDRPFEQVISSF-----DAGFQVHVQRVMTERGACYA 219
            .:::|:.   |....||:...| |.:.|:....|.::.:.     ..|.. :...|.|..|.||.
Zfish   185 WFSKLSDFRLFLPPRRFEGTSL-EFMDRLGHQLEDMLLACKYRGEPCGAH-NFSTVFTRYGKCYM 247

  Fly   220 INSP------MSTVLSGQPVAYELMPQPLSCQYGKQQCYIRMDLYESTGVLDVHSPFEVSATEAN 278
            .|:.      .:|:..|.....|:|..            |:.|.|     |.|....|.:|.||.
Zfish   248 FNAAEEGKTLRTTMKGGTGNGLEIMLD------------IQQDEY-----LPVWGETEETAFEAG 295

  Fly   279 I-VALHKSDE----------ITASFKVLETVASKNLRQLSVAQRKCVFNNEETSNLKIYSKSLCL 332
            : |.:|...|          :...|:.......:.|..|.....:||....::...::||.|.|.
Zfish   296 VRVQIHSQAEPPFVHELGFGVAPGFQTFVATQEQRLTYLPPPWGECVSRALDSGLFQVYSVSACR 360

  Fly   333 ARCRAVMALEMCNCVPFFYPYVDGPSCNPAGFECLLDFKWP-IWALHI-----CKCPSTC----- 386
            ..|.....:|.|||...:.| .|.|.|.|..::   |...| :.||..     |.|.|.|     
Zfish   361 IECETRYIVENCNCRMVYMP-GDSPYCTPEQYK---DCAEPALAALSAVEGTNCICRSPCNMTRY 421

  Fly   387 ------------TEIEYTMQTVKKSSWGVKNNEEVASSETATSSFRWDLIPPKVRMRRDVVYSFE 439
                        |...|..:...:|...:.:|  :...:....:..::.|..|      ..|...
Zfish   422 NKELSMVKIPSKTSARYLEKKFNRSEKYITDN--ILVLDVFFEALNYETIEQK------KAYEVA 478

  Fly   440 DLVVSFGGVLALFVGVSVMGLVEM---VHVLVNNLLLDV 475
            .|:...||.:.||:|.|::.|:|:   .:.:|...|||:
Zfish   479 GLLGDIGGQMGLFIGASILTLLELFDYAYEVVKERLLDL 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 100/473 (21%)
asic2XP_005164179.1 ASC 71..538 CDD:295594 107/495 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.