DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and ppk27

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_647826.2 Gene:ppk27 / 38440 FlyBaseID:FBgn0035458 Length:422 Species:Drosophila melanogaster


Alignment Length:410 Identity:80/410 - (19%)
Similarity:152/410 - (37%) Gaps:121/410 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 YFYFMDF-----LYAVVN--------ATAGNYAELAKFAEDE-RFDQIDL--------------- 181
            :|.|:.|     .|||.:        :|..:.:|| |..||| .|.::.:               
  Fly    40 WFLFISFGILFASYAVFSMVLEFLSYSTIADLSEL-KVLEDEIHFPELKICSGYKFSYRNMLASA 103

  Fly   182 YEMIQRVDRPFE------QVISSFDAGFQVHVQRVMTERGACYAINSPMSTVLSGQPVAYELMPQ 240
            ::::...::..:      .::|.:.....|..:.| .:..:...|.:..|.:|:..|....|:.:
  Fly   104 HDLVSSQNKSLDYWLNKLSLLSGYFDALSVKAENV-DDLNSLLDIKNISSFLLALTPACESLILK 167

  Fly   241 ------PLSC-------QYGKQQCYI-----------------RMDLYESTGVL---DVHSPFEV 272
                  |.:|       .|....|.:                 ::|.|...|.|   .:|.|   
  Fly   168 CKLNNIPANCLKLFTLKAYNDGNCCVLRNSNLTGELTLFMDSSQIDEYPLNGNLPGFSLHVP--- 229

  Fly   273 SATEANIVALHKSDEITASFKVLETVASKNLRQLSVAQRKCVFNNEETSNLKIYSKSLCLARCRA 337
              :....|:::..:......:|:|...:..|.:.:|.:|.|.|:.|..|..|      ||..||.
  Fly   230 --SWQGRVSINPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEGESREK------CLHECRI 286

  Fly   338 VMALEMCNCVPFFYPYVDGPS----CNPAGFEC--LLDFKW-PIWALHICKCPS---TCTEIEYT 392
            ...|..|.|||  ||:.....    |......|  |::..| |      .:||.   .|.::.|.
  Fly   287 KATLINCQCVP--YPFEFRTQKFGYCTLENIRCLQLVERNWSP------AQCPQCLPLCNQLFYR 343

  Fly   393 MQTVKKSSWGVKNNEEVAS------SETATSSFRWDLIPPKVRMRRDVVYSFEDLVVSFGGVLAL 451
            :            |:::..      ||.   :|::. .|.:.|.:.:::|.:..::.:.||||.:
  Fly   344 L------------NKQILGHLHPWRSEL---NFKFK-TPHRQRYKTNILYHWYQMLSNVGGVLGI 392

  Fly   452 FVGVSVMGLVEMVHVLVNNL 471
            .:|.|.:...|:::.||..|
  Fly   393 CIGCSFISGFELIYFLVFRL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 77/401 (19%)
ppk27NP_647826.2 ASC 15..407 CDD:279230 77/403 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.