DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and Nach

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster


Alignment Length:542 Identity:123/542 - (22%)
Similarity:212/542 - (39%) Gaps:130/542 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CVNRSIHLLE-----------RLFWLAVVVSSVIAALVLSRLQLERYFSSPTVISVDRDYRGWNG 111
            |...|||.|:           .|.||.:.|...|.|:|::|.....|.||||.::|:.|....|.
  Fly    31 CATSSIHGLKYTRDEDTNKIVHLVWLLISVVMFICAVVMARTFYMDYRSSPTRMNVESDNTPVNR 95

  Fly   112 -SLPAVTLCYYDHIDSFKANEYIQEM------------------WNVSIIDEDY----FYFMDFL 153
             ..|.||:|.....:..|:..::..:                  :...:.||.|    ...|:.|
  Fly    96 LYFPPVTICPDVLFNMQKSEAFLNTLRLPKGAELRGILRKLHIFYGFMLDDERYSAEDIEQMEAL 160

  Fly   154 YAVVNATAGNYAELAKFAEDE-----RF--DQIDLYEMIQRVDRPFEQVISSFD----------- 200
            ..:.|.|...:.|..::..||     ||  :.:|..::.| :.:.|.....||:           
  Fly   161 LFLNNLTIPEFVEHLRWNCDEILYRCRFNGEIMDCSKIFQ-LSKTFFGHCCSFNLRQKGWVNNKL 224

  Fly   201 ---AGFQV-HVQRV-MTERGACYAINSPMSTVLSGQPVAYELMPQPL-SCQYGKQQCYIRMDLYE 259
               ..|:| |:..: .|.:.|...:...:|.|:..:...|:    || |..||     :::.:.|
  Fly   225 NNLESFKVFHLNSLNFTAQRAIGGLRYGLSVVVRYKDDNYD----PLQSYSYG-----VKLLIQE 280

  Fly   260 STGVLDVHSPFEVSATEANIVALHKSDEITASFKVLETVASKNLRQLSVAQRKCVFNNEETSNLK 324
            :......||       .|..:|.  :.|..|:.:..||..|..::.|.:.:|.|||.||  ..::
  Fly   281 ADAFPSAHS-------AAKFIAF--NSETFAAVRPQETFCSSAVKALIIEERNCVFQNE--FPMR 334

  Fly   325 IYSKSL---CLARCRAVMALEMCNCVPFFYPY--VDGPSCNPAGFECLL--------------DF 370
            .:|..:   |...||....::.|.|..:|:.:  .....|......||:              ||
  Fly   335 YFSDYVYPNCELNCRVTNMVKFCGCHTYFFDFNRTSDRICTFRDIPCLVDNFGRLLLICSKYSDF 399

  Fly   371 KWPIWALHI-------CKCPSTCTEIEYTMQ-----------TVKKSSWGVKNNEEVASSETATS 417
            ...:.|..|       |.||.||..|:|.:|           ...|...|:..|:.|......:.
  Fly   400 NRLLSANIITRKKSTQCYCPLTCEHIDYDVQLTNFPLELNMPVADKFYSGLAKNDGVLHVFINSF 464

  Fly   418 SFRWDLIPPKVRMRRDVVYSFEDLVVSFGGVLALFVGVSVMGLVEMVH----VLVNNLLLDVFTL 478
            |:|        |:|||::.:...||.:.|...:||||:|::.:||:::    :|..|..|:..|.
  Fly   465 SYR--------RLRRDLLSNMVTLVSNLGSAFSLFVGMSMLSVVEIIYYFSVILRKNYKLECETR 521

  Fly   479 LRLMLGRLRRCWRR--DDHMRE 498
            .:::..:.:..|.:  |.|.:|
  Fly   522 SQMLHKKPKFAWPKANDTHSKE 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 114/499 (23%)
NachNP_001334724.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.