DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and degl-1

DIOPT Version :10

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001255829.1 Gene:degl-1 / 3565567 WormBaseID:WBGene00013333 Length:155 Species:Caenorhabditis elegans


Alignment Length:51 Identity:10/51 - (19%)
Similarity:26/51 - (50%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LFWLAVVVSSVIAALVLSRLQLERYFSSPTVISVDRDYRGWNGSLPAVTLC 119
            |.|..:::.|.:..:.|..:.:.:|||...:::::...  ...:.|::|.|
 Worm    79 LLWTTLLIISAVLFVYLITVTVRQYFSFQKLVNLNIGM--VESNFPSITFC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:459966 10/51 (20%)
degl-1NP_001255829.1 deg-1 61..>153 CDD:273309 10/51 (20%)

Return to query results.
Submit another query.