DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and ppk23

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:524 Identity:114/524 - (21%)
Similarity:188/524 - (35%) Gaps:195/524 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VAQAGAETGLLALSLCVNRSIHLLERLFWLAVVVSSVIAALVLSRLQLERYFSSPTVISVDRDYR 107
            :|::|...|               |:..|........:.|||:.....|::.::||:..:|.|:.
  Fly    46 IAESGRPIG---------------EKFMWFCFTSIGAVTALVIIMSLWEKFQTNPTITGLDTDFH 95

  Fly   108 GWNGSLPAVTLC---YYDHIDSFKANEYIQEMWNVSIIDEDYFYFMDFLYAVVNATAGNYAELAK 169
            ..|...|...:|   .:||                           |..|..|..|..||.|.  
  Fly    96 NQNVVFPTTVVCPEAAFDH---------------------------DKTYEKVYNTLANYDEA-- 131

  Fly   170 FAEDERFDQIDLYEMIQRVDRPFEQVISS--------------------FDA------GFQVHV- 207
                    |..:|       .||.::::|                    .||      .|:.|: 
  Fly   132 --------QAQMY-------TPFLRILTSLNFENVRDAKVLSQSIPQNLLDAHTIREWAFEGHID 181

  Fly   208 ---------------------QRVMTERGACYAINS-----PMSTVLSGQPVAYELMPQPLSCQY 246
                                 :.:.||.|.|||.||     |...|.:|.|              
  Fly   182 CKNVFVSCKYRDEDIPCCDHFEPIYTEHGFCYAFNSRFKSTPTEDVKTGAP-------------- 232

  Fly   247 GKQQCYIRMDLYE------------STGVLDVHSPFEVSATEANIVALHKSD----EITASFKVL 295
                    .||||            ||..:.:.|..|...::.| ..:..|:    |:..|.|  
  Fly   233 --------HDLYETDKKWALFFIPNSTSRIFIFSNEEYFGSDFN-AQIDWSEPQLVEVRISKK-- 286

  Fly   296 ETVASKNLRQLSVAQRKCVFNNEETSNL--KIYSKSLCLARCRAVMALEMCNCVPFFY------- 351
            .|..:.:.||||:.||||:|::|...|.  ..|:.|.|:.:||...|:::|.|.|.||       
  Fly   287 NTYTTDDARQLSIGQRKCIFSDEVKLNYFPDAYTFSSCMKQCRMNKAIKLCKCNPPFYKPIRELS 351

  Fly   352 -------------------PYVDGPSCNPAGFECLLDFKWPIWALHIC-KCPSTCTEIEYTMQTV 396
                               |..:.|.|:...|:||.:||..|..:..| :|..:|::..:.:..:
  Fly   352 CVINIFTNLIAYILLLYLTPKANVPMCSIKDFDCLDEFKSNITNIKDCLQCELSCSKTVFNIDKL 416

  Fly   397 KKSSWGVKNNEEVASSETATSSFRWDLIPPKVRMRRDVVYSFEDLVVSFGGVLALFVGVSVMGLV 461
                  :|.::...|.........|    |.:|.:|:|::.:.||:|||||:.:||:|.|::..|
  Fly   417 ------IKMSDRPESLGVLVEFLTW----PIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGV 471

  Fly   462 EMVH 465
            |:::
  Fly   472 EIIY 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 111/505 (22%)
ppk23NP_001097011.1 ASC 34..476 CDD:279230 114/524 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I7319
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.