DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and Asic2

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:542 Identity:120/542 - (22%)
Similarity:193/542 - (35%) Gaps:125/542 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VAQAG----AETGLLAL-SLCVNRSI---HLLERLFWLAVVVSSVIAALVLSRLQLERYFSSPTV 99
            ||:.|    :.|.|..| .:|..|:.   ....|..|:....:|:...|..|..:|..:.|.|  
  Rat    53 VARRGRPSLSRTKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTSLGLLLSWSSNRLLYWLSFP-- 115

  Fly   100 ISVDRDYRGWNGSL--PAVTLCYYDHIDSFKANEYIQEMWNVSIIDEDYFYFMDFLYAVV-NATA 161
             |..|.:|.|:..|  ||||:|..:.:...:.::            .|.:|...:|..:: |.||
  Rat   116 -SHTRVHREWSRQLPFPAVTVCNNNPLRFPRLSK------------GDLYYAGHWLGLLLPNRTA 167

  Fly   162 GN-YAELAKFAEDER--FDQIDLYEMIQRVDRPFEQVISSF--DAGFQV---------------- 205
            .. .:||.:..|..|  |.::..:.:. ...|.||.:.::|  ..|.|:                
  Rat   168 RPLVSELLRGDEPRRQWFRKLADFRLF-LPPRHFEGISAAFMDRLGHQLEDMLLSCKYRGELCGP 231

  Fly   206 -HVQRVMTERGACYAINSP------MSTVLSGQPVAYELMPQPLSCQYGKQQCYIRMDLYESTGV 263
             :...|.|:.|.||..||.      ::||..|.....|:|..            |:.|.|     
  Rat   232 HNFSSVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLD------------IQQDEY----- 279

  Fly   264 LDVHSPFEVSATEANI-VALHKSDE----------ITASFKVLETVASKNLRQLSVAQRKCVFNN 317
            |.:....|.:..||.: |.:|...|          :...|:.......:.|..|.....:|..:.
  Rat   280 LPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSE 344

  Fly   318 EETSNLKIYSKSLCLARCRAVMALEMCNCVPFFYPYVDGPSCNPAGF-EC------LLDFKWPIW 375
            .......:||.:.|...|.....:|.|||.....| .|.|.|.|... ||      ||..|...:
  Rat   345 MGLDFFPVYSITACRIDCETRYIVENCNCRMVHMP-GDAPFCTPEQHKECAEPALGLLAEKDSNY 408

  Fly   376 ALHICKCPSTCTEIEYTMQTVK-KSSWGVK------NNEEVASSETAT------SSFRWDLIPPK 427
            .|  |:.|...|.....:..|| .|....|      |..|...||...      .:..::.|..|
  Rat   409 CL--CRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK 471

  Fly   428 VRMRRDVVYSFEDLVVSFGGVLALFVGVSVMGLVEM---VHVLVNNLLLDVFTLLRLMLGRLRRC 489
                  ..|....|:...||.:.||:|.|::.::|:   ::.|:...|||       :||:....
  Rat   472 ------KAYEVAALLGDIGGQMGLFIGASLLTILELFDYIYELIKEKLLD-------LLGKEEEE 523

  Fly   490 WRRDDHMREAN---HHHHANAH 508
            ...|::|...:   :|....:|
  Rat   524 GSHDENMSTCDTMPNHSETISH 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 103/472 (22%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 117/531 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.