Sequence 1: | NP_726336.1 | Gene: | ppk3 / 246504 | FlyBaseID: | FBgn0050181 | Length: | 535 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491214.3 | Gene: | asic-1 / 191422 | WormBaseID: | WBGene00022815 | Length: | 823 | Species: | Caenorhabditis elegans |
Alignment Length: | 314 | Identity: | 58/314 - (18%) |
---|---|---|---|
Similarity: | 103/314 - (32%) | Gaps: | 103/314 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 233 VAYELMPQPLSCQYGKQQCYIRMDLYESTGVLD-------------------------------- 265
Fly 266 VHSPFEVSATEANIVAL--HKSDE--------------ITASFKVLETVASKNLRQLSVAQRKCV 314
Fly 315 FNNEETSNL---KIYSKSLCLARCRAVMALEMCNC-VPFFYPYVDGPSC---NPAGFECLLDFKW 372
Fly 373 PIWALHI---------CKCPSTCTEIEYTMQTVKKSSW------------GVK-------NNEEV 409
Fly 410 ASSETATSSFRWDLIPPKVRMRRDVVYSFEDLVVSFGGVLALFVGVSVMGLVEM 463 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ppk3 | NP_726336.1 | ASC | 59..464 | CDD:279230 | 58/314 (18%) |
asic-1 | NP_491214.3 | deg-1 | 16..779 | CDD:273309 | 58/314 (18%) |
ASC | 17..>104 | CDD:279230 | |||
ASC | <469..788 | CDD:295594 | 58/314 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D303969at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11690 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |