DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and asic-1

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_491214.3 Gene:asic-1 / 191422 WormBaseID:WBGene00022815 Length:823 Species:Caenorhabditis elegans


Alignment Length:314 Identity:58/314 - (18%)
Similarity:103/314 - (32%) Gaps:103/314 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 VAYELMPQPLSCQYGKQQCYIRMDLYESTGVLD-------------------------------- 265
            ::|......:.|.:..::|.::.|..|   .||                                
 Worm   483 ISYNKSDFIMKCSFNGRECNVKHDFVE---YLDPTYGACFTYGQKLGNNTNERSGPAYGLRLEVF 544

  Fly   266 VHSPFEVSATEANIVAL--HKSDE--------------ITASFKVLETVASKNLRQLSVAQRKCV 314
            |:....:..|||..|.|  |.:||              ..:||    .:..|::.:|......||
 Worm   545 VNVTEYLPTTEAAGVRLTVHATDEQPFPDTLGFSAPTGFVSSF----GIKLKSMVRLPAPYGDCV 605

  Fly   315 FNNEETSNL---KIYSKSLCLARCRAVMALEMCNC-VPFFYPYVDGPSC---NPAGFECLLDFKW 372
            ...:....:   |.|:...|...|......:.|.| .|.|.||.:..:|   :|...||:.:   
 Worm   606 REGKTEDFIYTQKAYNTEGCQRSCIQKHLSKTCGCGDPRFPPYRESKNCPVDDPYKRECIKN--- 667

  Fly   373 PIWALHI---------CKCPSTCTEIEYTMQTVKKSSW------------GVK-------NNEEV 409
               .:|:         |.|...|.:..|:: :...|.|            |:.       ..|:.
 Worm   668 ---EMHVATRDSKKLGCSCKQPCNQDVYSV-SYSASRWPAIAGDLSGCPLGMAAHHCLNYKREQG 728

  Fly   410 ASSETATSSFRWDLIPPKVRMRRDVVYSFEDLVVSFGGVLALFVGVSVMGLVEM 463
            :..|.......::      .:.....|.:.:|:..|||.|.|::||||:.:.|:
 Worm   729 SMIEVYFEQLNYE------SLLESEAYGWSNLLSDFGGQLGLWMGVSVITIGEV 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 58/314 (18%)
asic-1NP_491214.3 deg-1 16..779 CDD:273309 58/314 (18%)
ASC 17..>104 CDD:279230
ASC <469..788 CDD:295594 58/314 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.