DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and del-10

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_495302.3 Gene:del-10 / 174069 WormBaseID:WBGene00020897 Length:1069 Species:Caenorhabditis elegans


Alignment Length:434 Identity:74/434 - (17%)
Similarity:128/434 - (29%) Gaps:173/434 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SIHLLE------RLFWLAVVVSSVIAALVLSRLQLERYFSSPTVISVDRDYRGWNGSLPAVTLCY 120
            ::|.|.      |..|..::::.||..||....|::.|.|.|...:::.:|.. ..|.|.|.:|.
 Worm    82 AVHHLNAASPVTRGLWCMIIIAFVILVLVQCYSQIKLYISEPVATNIEAEYPS-KISFPTVAICN 145

  Fly   121 YDHID-SFKANEYIQEMWNVSIIDEDYFYFMDFLYAVVNATAGNYAELAKFAEDERFDQI----- 179
            .:... ::.....|....:.||                   :|:........|.. ||.:     
 Worm   146 NNQFRLTYLTGGRIMNRRSKSI-------------------SGSLLSTGHDVESV-FDTVLRKSW 190

  Fly   180 --DLYEMIQRVDRPFEQVI-------------SSFDAGFQVHVQRVMTERGACYAINSPMSTVLS 229
              |..:.::.......::|             |.|.|        |.|..|.|:|||:       
 Worm   191 DMDAVKFLRSAAHWKSRMILGCTWPNGTSCKLSDFKA--------VWTTTGLCWAINT------- 240

  Fly   230 GQPVAYELMPQPLSCQYGKQQCYIRMDLYESTGVLDVHSPFEVSATE--------ANIVALHKSD 286
                                               |.|:|:||:.:.        .|:.:..:.|
 Worm   241 -----------------------------------DPHNPYEVTGSGEGHGLRLLLNVESYERVD 270

  Fly   287 EITASFKVLETVASKNLRQLSVAQRKCVFNNEETSNLKI--------YSKSLCLARCRAVMALEM 343
            ..|..|:      :|.|..|.:    .::|..:..:..:        ||..              
 Worm   271 ACTKHFR------TKTLPGLKI----LIYNQTDIPDSSMNGVNVPSGYSMD-------------- 311

  Fly   344 CNCVPFFYPY---VDGPSC---NPAGFECLLDFKWPIWALHICKCPSTCTEIE----------YT 392
               :||...:   :.|..|   |....|...||..| ..:..|......||:|          ||
 Worm   312 ---IPFKMQHRSKLTGVHCIEENDEQIEASTDFNNP-ENIRTCTLRRYMTEVENSCHCTLRRAYT 372

  Fly   393 MQT--VKKSSWGV--------KNNEEVASSETATSSFRWDLIPP 426
            ..:  ||..:..|        |..:.:....||::     .:||
 Worm   373 SNSTDVKMKACNVDQYFGCAQKAMQRIREEGTAST-----CLPP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 74/434 (17%)
del-10NP_495302.3 ASC 83..>419 CDD:279230 74/433 (17%)
ASC <789..849 CDD:279230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.