DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk3 and LOC101731449

DIOPT Version :9

Sequence 1:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_031747978.1 Gene:LOC101731449 / 101731449 -ID:- Length:534 Species:Xenopus tropicalis


Alignment Length:546 Identity:126/546 - (23%)
Similarity:198/546 - (36%) Gaps:170/546 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RSIHLLERLFWLAVVVSSVIAALVLSRLQLERYFSSPT-----VISVDRDYRGWNGSLPAVTLCY 120
            ||.|...|:.||..|..::..||......:..|::.|:     :||..:      ...||||:|.
 Frog    48 RSKHWFRRMVWLVFVSFALCCALWQCTQMVLTYYTYPSHEKIMLISSAK------LKFPAVTICN 106

  Fly   121 YDHI------DSFKANEYIQEM-------------WNVS--IIDEDYFYFMDFLYAVVNATAGNY 164
            .:.:      .||..:..:|:.             .||:  .:||:..|          |:|.| 
 Frog   107 LNSVRLSSLGRSFSMSNSLQDSGLEMTHRRNRSHHMNVTSDSVDENVLY----------ASAFN- 160

  Fly   165 AELAKFAEDERFDQI----------DLYEMIQRVDRPFEQVISSFDAGFQVHVQRVMTERGACYA 219
                |||.:  |:|:          .|.:|:...:...::..|||.:||      :..:.|.||.
 Frog   161 ----KFASE--FNQLPDEQKIEMGHQLEDMLIFCNFHGQECNSSFFSGF------INYKFGNCYT 213

  Fly   220 INSPMSTVLSGQPVAYELMPQPLSC-----QYG-------KQQCYIRMDLYESTGV-LDVHS--- 268
            .||..|..:.|..:..:    ||:.     .||       :|..|:| |:..:.|: |.||.   
 Frog   214 FNSQKSVDIRGNQIRVD----PLNITKAGFMYGLHLELFIQQIEYVR-DMTHAAGIRLLVHDQAQ 273

  Fly   269 -PFEV---------SATEANIVALHKSDEITASFKVLETVASKNLRQLSVAQRKCVFNNEETSNL 323
             ||..         :.||..::.:|                   :.:|...........|...|.
 Frog   274 MPFPEDEGVNVPPGAETEIGMMKVH-------------------INRLRAPYGSHCTQGEGIKNF 319

  Fly   324 ------KIYSKSLCLARCRAVMALEMCNCV--PFFYPYVDG--PSCNPAGF---EC--LLDFKWP 373
                  ..|::..|...|.....::.|.|.  .|.:| .:|  |.||.:..   :|  |.:||:.
 Frog   320 YKDIYGAGYTREACKRTCAQQSIMDNCGCTHWEFAFP-KEGNYPKCNVSNAAIRDCVKLYEFKFA 383

  Fly   374 IWALHICKCPSTCTEIEYTMQTVKKSSWGVKNNEEVASSETATSSFRWDLIPPKVRMRRD----- 433
            ...|: |.||..|:|..|.: ||..|.|......|..|.|......:...|.....|.||     
 Frog   384 HDELN-CHCPLQCSEDLYEL-TVSGSQWPSTAFIENFSRELKEMGGQMRDIADSPSMIRDNFVKV 446

  Fly   434 VVY----SFE-----------DLVVSFGGVLALFVGVSVMGLVEMVHVLVNNLLLDVFTLLRLML 483
            |||    :||           :|:.:.||::.|:||.||..|.|..     .|.|||....    
 Frog   447 VVYFKQLNFELIEEEPSMTEINLISNMGGLVGLWVGFSVCTLAEFF-----ELFLDVLFYF---- 502

  Fly   484 GRLRRCWRRDDHMREANHHHHANAHA 509
              ::||      ::.|....:||.:|
 Frog   503 --VQRC------LKMAAREGYANPYA 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk3NP_726336.1 ASC 59..464 CDD:279230 116/499 (23%)
LOC101731449XP_031747978.1 ASC 35..494 CDD:395688 116/506 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.