DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and FHL5

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001164278.1 Gene:FHL5 / 9457 HGNCID:17371 Length:284 Species:Homo sapiens


Alignment Length:178 Identity:47/178 - (26%)
Similarity:79/178 - (44%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ASICCRCNEKIWP--RAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARC 65
            :|.|..|...|.|  |.:...|..:|...|.|:.|...:..|...:.:....|..|:..:.|..|
Human    99 SSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYC 163

  Fly    66 SACRTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKP 130
            :.|:..|...|:...::.||::||.|..|.|.|....|...:.|.||...:..|::::|..|.||
Human   164 NFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKP 228

  Fly   131 ID----RRAVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            |.    .:.:....::||::||.|..|...:..:.|..:|.:..|..|
Human   229 ISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 13/56 (23%)
LIM 65..116 CDD:259829 16/50 (32%)
LIM 124..171 CDD:295319 13/50 (26%)
FHL5NP_001164278.1 LIM <5..34 CDD:351770
LIM1_FHL 37..95 CDD:188729
LIM2_FHL5 102..155 CDD:188812 12/52 (23%)
LIM3_FHL 163..214 CDD:188732 16/50 (32%)
LIM4_FHL 222..277 CDD:188733 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.