DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and LPXN

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001137467.1 Gene:LPXN / 9404 HGNCID:14061 Length:391 Species:Homo sapiens


Alignment Length:169 Identity:54/169 - (31%)
Similarity:85/169 - (50%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACRT 70
            |..|...|..:.:.::.:|:||.||.|..||.|...:.|...|....|.:.:|...:.:|..|..
Human   216 CAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNR 280

  Fly    71 PILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRA 135
            |:||..::|.:..||.:||.|..|..|..:.||||::|..||:.|:.....:.|.||.:||..|.
Human   281 PVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRC 345

  Fly   136 VVALSTKWHAKCFKCHHCRKRISAREFWIENGQPICAAC 174
            :.|:..|:|.:.|.|..|..::|...|..:|.:..|..|
Human   346 ISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPC 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 16/54 (30%)
LIM 65..116 CDD:259829 20/50 (40%)
LIM 124..171 CDD:295319 15/46 (33%)
LPXNNP_001137467.1 LIM1_Leupaxin 155..209 CDD:188790
LIM2_Leupaxin 216..267 CDD:188792 15/50 (30%)
LIM3_Leupaxin 275..327 CDD:188794 21/51 (41%)
LIM4_Paxillin_like 334..385 CDD:188725 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149730
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.