DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and LRG1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_010041.2 Gene:LRG1 / 851358 SGDID:S000002399 Length:1017 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:58/190 - (30%)
Similarity:85/190 - (44%) Gaps:33/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWP------RAVCSLGKTYHPHHFTCKECGLVVDPKLF-FAVDDD----VVCSECYL 58
            ||.|||:.:.|      ..:.:|||.||...|||::|...:.||.| :.||..    ::|...|.
Yeast    27 ICARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKPLKPKYFPYQVDKTSESILLCQYDYF 91

  Fly    59 DKHAARCSACRTPILERGV--AAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFS 121
            .:|...|..|.||:  ||:  .|...::.|:.|.|..|:........|.....|:||.||.:.||
Yeast    92 RRHNLLCHVCDTPL--RGLYYTAFGYRYDEEHFSCTICATPCGVKKCFMYGNQLYCKYHFLKYFS 154

  Fly   122 SRCAGCEKPIDRRAVVALSTK----WHAKCFKCHHCRKRISAREFWIENGQPICAACQTV 177
            .||.|||.||..:.:.....:    ||.:|:..|         ::|..|     .|.:||
Yeast   155 KRCKGCEFPISDQYIEFPKGEEIHCWHPECYGIH---------KYWHVN-----LAAETV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 21/65 (32%)
LIM 65..116 CDD:259829 15/52 (29%)
LIM 124..171 CDD:295319 12/50 (24%)
LRG1NP_010041.2 LIM1_Lrg1p_like 28..90 CDD:188777 20/61 (33%)
LIM 98..149 CDD:259829 15/52 (29%)
LIM3_Lrg1p_like 419..475 CDD:188779
RhoGAP_fLRG1 728..959 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - oto99421
orthoMCL 1 0.900 - - OOG6_111250
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1093
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.