DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and Tgfb1i1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_006230411.1 Gene:Tgfb1i1 / 84574 RGDID:620173 Length:473 Species:Rattus norvegicus


Alignment Length:167 Identity:61/167 - (36%)
Similarity:84/167 - (50%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ICCRCNEKIWPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSACR 69
            :|..||:.|..:.|.:||:.:||.||.|:.|...:....||..|....|.|||.::.:.||..|.
  Rat   239 LCGSCNKPIAGQVVTALGRAWHPEHFLCRGCSTTLGGSSFFEKDGAPFCPECYFERFSPRCGFCN 303

  Fly    70 TPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRR 134
            .||..:.|.|....||.:.|.||||.:......|.|..|..:|:..|.:||:.||.||:.||...
  Rat   304 QPIRHKMVTALGTHWHPEHFCCVSCGEPFGEEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDN 368

  Fly   135 AVVALSTKWHAKCFKCHHCRKRISAREFWIENGQPIC 171
            .:.|||..||..||.|..|....|...|:...|:|:|
  Rat   369 YISALSALWHPDCFVCRECLAPFSGGSFFEHEGRPLC 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 20/54 (37%)
LIM 65..116 CDD:259829 17/50 (34%)
LIM 124..171 CDD:295319 18/46 (39%)
Tgfb1i1XP_006230411.1 Paxillin <69..>118 CDD:281527
LIM1_Paxillin_like 240..292 CDD:259830 19/51 (37%)
LIM2_Paxillin_like 299..350 CDD:188723 17/50 (34%)
LIM3_Paxillin 358..410 CDD:188793 19/48 (40%)
LIM4_Leupaxin 417..468 CDD:188796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.