DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and PLIM2b

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_171683.1 Gene:PLIM2b / 839267 AraportID:AT1G01780 Length:205 Species:Arabidopsis thaliana


Alignment Length:188 Identity:39/188 - (20%)
Similarity:66/188 - (35%) Gaps:70/188 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LDKHAARCSACRTPILERGVAAAE-RKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELF- 120
            |||    |:.|...:....:.:.| ..:|:.||||..|..:|..:::..::|.|:||.||.:|| 
plant     7 LDK----CNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKTHFEQLFK 67

  Fly   121 ---------------------------------SSRCAGCEKPIDRRAVVALSTK-WHAKCFKCH 151
                                             ..:||.|||.:.....:.:..: :|..||:|.
plant    68 ESGNFSKNFQPGKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEKIQMEGECFHKTCFRCA 132

  Fly   152 H------------------CRKRISAREFWIENGQPI----------CAACQTVVPSP 181
            |                  ||...:  :.::|.|...          .|:..|:.|.|
plant   133 HGGCTLTHSSYASLDSVLYCRHHFN--QLFMEKGNYAHVLQAANHRRTASGNTLPPEP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319 2/2 (100%)
LIM 65..116 CDD:259829 14/51 (27%)
LIM 124..171 CDD:295319 14/75 (19%)
PLIM2bNP_171683.1 LIM1_SF3 6..68 CDD:188824 21/64 (33%)
LIM 104..164 CDD:413332 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.