DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and WLIM1

DIOPT Version :9

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:152 Identity:38/152 - (25%)
Similarity:57/152 - (37%) Gaps:46/152 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RCSAC-RTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFS------ 121
            :|.|| :|..|...:.|..|.:|:.||||..|..:|..:::....|.|:|:.||.:.|.      
plant     9 KCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQNFKRTGSLE 73

  Fly   122 ----------------------------------SRCAGCEK---PIDRRAVVALSTKWHAKCFK 149
                                              .:|.||:|   ||::  |....|.:|..|||
plant    74 KSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK--VSVNGTLYHKSCFK 136

  Fly   150 CHHCRKRISAREFWIENGQPIC 171
            |.|....||...:....|:..|
plant   137 CTHGGCTISPSNYIAHEGKLYC 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:295319
LIM 65..116 CDD:259829 17/51 (33%)
LIM 124..171 CDD:295319 17/49 (35%)
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824 20/58 (34%)
LIM2_SF3 110..170 CDD:188825 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.