DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and WLIM1

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_172491.1 Gene:WLIM1 / 837558 AraportID:AT1G10200 Length:190 Species:Arabidopsis thaliana


Alignment Length:152 Identity:38/152 - (25%)
Similarity:57/152 - (37%) Gaps:46/152 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RCSAC-RTPILERGVAAAERKWHEKCFRCVSCSKSLVSASFFEVNGYLFCKAHFRELFS------ 121
            :|.|| :|..|...:.|..|.:|:.||||..|..:|..:::....|.|:|:.||.:.|.      
plant     9 KCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHFDQNFKRTGSLE 73

  Fly   122 ----------------------------------SRCAGCEK---PIDRRAVVALSTKWHAKCFK 149
                                              .:|.||:|   ||::  |....|.:|..|||
plant    74 KSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK--VSVNGTLYHKSCFK 136

  Fly   150 CHHCRKRISAREFWIENGQPIC 171
            |.|....||...:....|:..|
plant   137 CTHGGCTISPSNYIAHEGKLYC 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332
LIM 65..116 CDD:259829 17/51 (33%)
LIM 124..171 CDD:413332 17/49 (35%)
WLIM1NP_172491.1 LIM1_SF3 6..68 CDD:188824 20/58 (34%)
LIM2_SF3 110..170 CDD:188825 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.