DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and DAR6

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_201463.1 Gene:DAR6 / 836794 AraportID:AT5G66620 Length:644 Species:Arabidopsis thaliana


Alignment Length:160 Identity:35/160 - (21%)
Similarity:58/160 - (36%) Gaps:52/160 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SICCRCNEKI-WPRAVCSLGKTYHPHHFTCKECGLVVDPKLFFAVDDDVVCSECYLDKHAARCSA 67
            |:|..||..: ...:|..||..:||..|.|:                                 |
plant   284 SLCGGCNFAVEHGGSVNILGVLWHPGCFCCR---------------------------------A 315

  Fly    68 CRTPI----LERGVAAAERKWHEKCFR--CVSCS----KSLVSASFFEVNGYLFCKAHFRELFSS 122
            |..||    :|..|:.:..|:|:.|:.  |..|.    |:..:..|:|..   :|..|..: .:.
plant   316 CHKPIAIHDIENHVSNSRGKFHKSCYERYCYVCKEKKMKTYNNHPFWEER---YCPVHEAD-GTP 376

  Fly   123 RCAGCEK--PIDRRAVVALSTKWHAKCFKC 150
            :|..||:  |.:...|:....:|  .|.:|
plant   377 KCCSCERLEPRESNYVMLADGRW--LCLEC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332 10/55 (18%)
LIM 65..116 CDD:259829 15/60 (25%)
LIM 124..171 CDD:413332 8/29 (28%)
DAR6NP_201463.1 Smc <27..>220 CDD:440809
LIM_DA1 286..341 CDD:188782 18/87 (21%)
DA1-like 428..642 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.