DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30178 and DAR4

DIOPT Version :10

Sequence 1:NP_726395.1 Gene:CG30178 / 246501 FlyBaseID:FBgn0050178 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_197291.2 Gene:DAR4 / 831657 AraportID:AT5G17890 Length:1613 Species:Arabidopsis thaliana


Alignment Length:150 Identity:36/150 - (24%)
Similarity:64/150 - (42%) Gaps:40/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VDDD-------VVCSECYLDKHA----ARCSACRTPILERGVA--AAERKWHEKCFRCVSCSKSL 98
            :|||       :..|:.::::..    ::|..|::.| |.|::  |....||.:||.|:.|.:.:
plant  1211 LDDDKADEKEQIKHSKDHVEEEVNPPLSKCKDCKSAI-EDGISINAYGSVWHPQCFCCLRCREPI 1274

  Fly    99 VSASFFEVNGYLFCKAHFRELFSSRCAGCEKPIDRRAVVALSTKWHAKCFKCHHCRKRISAREFW 163
            ......::.| ::.|..::||....|..|||.|.|   .|...|:|              ...||
plant  1275 AMNEISDLRG-MYHKPCYKELRHPNCYVCEKKIPR---TAEGLKYH--------------EHPFW 1321

  Fly   164 IE--------NGQPICAACQ 175
            :|        :|.|.|.:|:
plant  1322 METYCPSHDGDGTPKCCSCE 1341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30178NP_726395.1 LIM 6..61 CDD:413332 4/20 (20%)
LIM 65..116 CDD:259829 14/52 (27%)
LIM 124..171 CDD:413332 14/54 (26%)
DAR4NP_197291.2 PLN03210 26..>844 CDD:215633
leucine-rich repeat 544..572 CDD:275380
leucine-rich repeat 573..594 CDD:275380
leucine-rich repeat 595..617 CDD:275380
leucine-rich repeat 618..640 CDD:275380
leucine-rich repeat 641..663 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 750..772 CDD:275380
leucine-rich repeat 773..793 CDD:275380
leucine-rich repeat 794..824 CDD:275380
LIM_DA1 1240..1291 CDD:188782 14/52 (27%)
DA1-like 1387..1603 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.